FUT1 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-FUT1 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | FUT1 |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Galactoside 2-alpha-L-fucosyltransferase 1(FUT1) detection. Tested with WB, IHC-P in Human;Mouse; Rat. Background: Galactoside 2-alpha-L-fucosyltransferase 1 is an enzyme that in humans is encoded by the FUT1 gene. It is mapped to 19q13.3. The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of a precursor of the H antigen, which is required for the final step in the soluble A and B antigen synthesis pathway. This gene is one of two encoding the galactoside 2-L-fucosyltransferase enzyme. Mutations in this gene are a cause of the H-Bombay blood group. |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human FUT1 (134-164aa EVDSRTPWRELQLHDWMSEEYADLRDPFLKL), different from the related mouse and rat sequences by seven amino acids. Ig Type: Rabbit IgG |
| Other Names | [Galactoside 2-alpha-L-fucosyltransferase 1; 2)FT 1; 2-alpha-L-fucosyltransferase; Alpha (1 2) fucosyltransferase; Alpha(1 2)FT 1; Alpha(1; Blood group H alpha 2-fucosyltransferase; fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase); Fucosyltransferase 1; FUT1; FUT1_HUMAN; Galactoside 2 alpha L fucosyltransferase; Galactoside 2-alpha-L-fucosyltransferase 1; GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 1; H; HH; HSC; Para Bombay phenotype; fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group)], [FUT1; FUT1; H; HH; HSC; H; HSC] |
| Gene, Accession # | [FUT1], Gene ID: 2523, NCBI: NP_000139.1, UniProt: P19526 |
| Catalog # | MBS178100 |
| Price | $315 |
| Order / More Info | FUT1 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Entrez Gene: FUT1 fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group). 2. Ball SP, Tongue N, Gibaud A et al. (1992). The human chromosome 19 linkage group FUT1 (H), FUT2 (SE), LE, LU, PEPD, C3, APOC2, D19S7 and D19S9. Ann. Hum. Genet. 55 (Pt 3): 225-33. 3. Yip SP, Chee KY, Chan PY et al. (2003). Molecular genetic analysis of para-Bombay phenotypes in Chinese: a novel non-functional FUT1 allele is identified. Vox Sang. 83 (3): 258-62. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies