Edit |   |
---|---|
Antigenic Specificity | L1CAM |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 0.1 mg |
Concentration | n/a |
Applications | Immunohistochemistry (IHC) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Description: L1, also known as L1CAM, is a transmembrane protein member of the L1 protein family, encoded by the L1CAM gene. The protein encoded by this gene is an axonal glycoprotein belonging to the immunoglobulin supergene family. The ectodomain, consisting of several immunoglobulin-like domains and fibronectin-like repeats (type III), is linked via a single transmembrane sequence to a conserved cytoplasmic domain. This cell adhesion molecule plays an important role in nervous system development, including neuronal migration and differentiation. Mutations in the gene cause X-linked neurological syndromes known as CRASH (corpus callosum hypoplasia, retardation, aphasia, spastic paraplegia and hydrocephalus). Alternative splicing of this g |
Immunogen | Immunogen: A synthetic peptide corresponding to a sequence of human L1CAM (NMVITWKPLRWMDWNAPQVQYRVQWRPQGTRGPW). Subcellular Localization: Cell membrane. |
Other Names | [Neural cell adhesion molecule L1; N-CAM-L1; NCAM-L1; CD171; L1CAM; CAML1; MIC5] |
Gene, Accession # | [L1CAM], Gene ID: 3897, NCBI: NP_000416.1, UniProt: P32004 |
Catalog # | MBS1750469 |
Price | $315 |
Order / More Info | L1CAM Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |