UBE2I UBC9 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-UBE2I UBC9 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | UBE2I UBC9 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Specificity: No cross reactivity with other proteins. Description: Rabbit IgG polyclonal antibody for UBE2I UBC9 detection. Tested with WB, IHC-P in Human; Mouse; Rat.Background: SUMO-conjugating enzyme UBC9 (UBE2I), also called UBC9, is a protein that in humans is encoded by the UBE2I gene. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. It is mapped to 16p13.3. UBC9 could fully complement the mutant phenotype of a yeast ubc9 mutant strain. This gene may play a similar role via interaction with WT1, which is able to impose a block to cell cycle progression in eukaryotic cells. What's more, it could support the growth of yeast ubc9 temperature-sensitive mutants at nonpermissive temperatures, indicating that the |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence of human UBE2I UBC9 (NIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAPS). |
| Other Names | [SUMO-conjugating enzyme UBC9; Ubiquitin conjugating enzyme E2 I] |
| Gene, Accession # | [UBE2I UBC9], Gene ID: 7329, NCBI: NP_003336.1, UniProt: P63279 |
| Catalog # | MBS1751415 |
| Price | $315 |
| Order / More Info | UBE2I UBC9 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Shi, Y., Zou, M., Farid, N. R., Paterson, M. C. Association of FHIT (fragile histidine triad), a candidate tumour suppressor gene, with the ubiquitin-conjugating enzyme hUBC9. Biochem. J. 352: 443-448, 2000. 2. Wang, Z.-Y., Qiu, Q.-Q., Seufert, W., Taguchi, T., Testa, J. R., Whitmore, S. A., Callen, D. F., Welsh, D., Shenk, T., Deuel, T. F. Molecular cloning of the cDNA and chromosome localization of the gene for human ubiquitin-conjugating enzyme 9. J. Biol. Chem. 271: 24811-24816, 1996. 3. Watanabe TK, Fujiwara T, Kawai A, Shimizu F, Takami S, Hirano H, Okuno S, Ozaki K, Takeda S, Shimada Y, Nagata M, Takaichi A, Takahashi E, Nakamura Y, Shin S (March 1996). Cloning, expression, and mapping of UBE2I, a novel gene encoding a human homologue of yeast ubiquitin-conjugating enzymes which are critical for regulating the cell cycle.Cytogenet Cell Genet 72 (1): 86-9. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies