Edit |   |
---|---|
Antigenic Specificity | IL22 Picoband |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 0.1 mg |
Concentration | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Description: Interleukin-22 (IL-22), also known as ILTIF, is protein that in humans is encoded by the IL22 gene. IL-22 a member of a group of cytokines called the IL-10 family or IL-10 superfamily, a class of potent mediators of cellular inflammatory responses. Using FISH, the IL22 gene is mapped to chromosome 12q15, close to the IFNG and the herpesvirus saimiri-induced AK155 genes. IL-22 can contribute to immune disease through the stimulation of inflammatory responses, S100s and defensins. It also promotes hepatocyte survival in the liver and epithelial cells in the lung and gut similar to IL-10. In some contexts, the pro-inflammatory versus tissue-protective functions of IL-22 are regulated by the often co-expressed cytokine IL-17A.P |
Immunogen | Immunogen: A synthetic peptide corresponding to a sequence of human IL22 (DDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNA). Subcellular Localization: Secreted. |
Other Names | [Interleukin-22; IL-22; Cytokine Zcyto18; IL-10-related T-cell-derived-inducible factor; IL-TIF; IL22; ILTIF; ZCYTO18; UNQ3099/PRO10096] |
Gene, Accession # | [IL22], Gene ID: 50616, NCBI: NP_065386.1, UniProt: Q9GZX6 |
Catalog # | MBS1750524 |
Price | $280 |
Order / More Info | IL22 Picoband Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |