Munc18-1 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-Munc18-1 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Munc18-1 |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Syntaxin-binding protein 1(STXBP1) detection. Tested with WB, IHC-P in Human;Mouse;Rat. Background: Syntaxin-binding protein 1, also known as Munc18-1, is a protein that in humans is encoded by the STXBP1 gene. By fluorescence in situ hybridization, the STXBP1 gene is mapped to chromosome 9q34.1. This gene encodes a syntaxin-binding protein. The encoded protein appears to play a role in release of neurotransmitters via regulation of syntaxin, a transmembrane attachment protein receptor. Mutations in this gene have been associated with infantile epileptic encephalopathy-4. Alternatively spliced transcript variants have been described. |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Munc18-1 (184-216aa KEYPAVRYRGEYKDNALLAQLIQDKLDAYKADD), identical to the related mouse and rat sequences. Ig Type: Rabbit IgG |
| Other Names | [Syntaxin-binding protein 1; FLJ37475; Munc 18 1; Munc 18a; MUNC18 1; N-Sec1; Neuronal SEC1; NSec1; p67; Protein unc-18 homolog 1; Protein unc-18 homolog A; Rb sec1; RBSEC1; STXB1_HUMAN; STXBP1; Syntaxin binding protein 1; Syntaxin-binding protein 1; Unc 18 homolog; Unc 18A; Unc-18A; Unc18 1; UNC18; Unc18-1; syntaxin binding protein 1], [STXBP1; STXBP1; P67; NSEC1; UNC18; RBSEC1; MUNC18-1; UNC18A; Unc18-1; Unc-18A] |
| Gene, Accession # | Gene ID: 6812, NCBI: NP_001027392.1, UniProt: P61764 |
| Catalog # | MBS177686 |
| Price | $315 |
| Order / More Info | Munc18-1 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Entrez Gene: STXBP1 syntaxin binding protein 1. 2. Fisher, R. J., Pevsner, J., Burgoyne, R. D. Control of fusion pore dynamics during exocytosis by Munc18. Science 291: 875-878, 2001. 3. Swanson DA, Steel JM, Valle D (Jun 1998). Identification and characterization of the human ortholog of rat STXBP1, a protein implicated in vesicle trafficking and neurotransmitter release. Genomics 48 (3): 373-6. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies