SUR1/SUR2B Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-SUR1/SUR2B antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | SUR1/SUR2B |
| Clone | [S323A-31] |
| Host Species | Mouse |
| Reactive Species | mouse, rat |
| Isotype | IgG1 |
| Format | APC-Cy7 conjugate |
| Size | 0.1 mg |
| Concentration | 1 mg/ml |
| Applications | Western Blot (WB), Immunocytochemistry (ICC), Immunofluorescence (IF) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Detects ~175 kDa and smaller fragments likely due to proteolytic cleavage. Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins are subunits of the inward-rectifier potassium ion channels Kir6.x (6.1 and 6.2) (1). The association of four Kir6.x and four SUR subunits form an ion conducting channel commonly referred to as the KATP channel. The primary function of the sulfonylurea receptor is to sense intracellular levels of the nucleotides ATP and ADP and in response facilitate the open or closing its associated Kir6.x potassium channel. Hence the KAT |
| Immunogen | Immunogen: Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B |
| Other Names | [Mouse Rat SUR1 and SUR2B IgG1; SUR1 and SUR2B : APC/Cy7; ABC36; Abcc8; ABCC8_HUMAN; ATP binding cassette sub family C (CFTR/MRP) member 8; ATP binding cassette transporter sub family C member 8 (1); ATP-binding cassette sub-family C member 8; HHF1; HI; HRINS; MRP8; PHHI; Sulfonylurea receptor (hyperinsulinemia); Sulfonylurea receptor 1; SUR; SUR1; SUR1delta2; TNDM2; ABC37; abcC9; ABCC9_HUMAN; AI414027; AI449286; ATFB12; ATP-binding cassette sub-family C member 9; ATP-binding cassette transporter sub-family C member 9; ATP-binding cassette; sub-family C (CFTR/MRP); member 9; CANTU; CMD1O; FLJ36852; Sulfonylurea receptor 2; Sulfonylurea-binding protein 2; SUR2; SUR2A; SUR2B] |
| Gene, Accession # | [SUR1/SUR2B], Gene ID: 25560, NCBI: NP_037172.2, UniProt: Q63563 |
| Catalog # | MBS8003286 |
| Price | $510 |
| Order / More Info | SUR1/SUR2B Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Campbell J.D., Sansom M.S., Ashcroft F.M. (2003) EMBO Resp. 4(11): 1038-1042. 2. Nichols C.G. (2006) Nature. 440 (7083): 470-476. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies