Perilipin 3 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-Perilipin 3 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Perilipin 3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat. |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal antibody for Perilipin-3 (PLIN3) detection. Background: Mannose-6-phosphate receptor binding protein 1 (M6PRBP1), also known as Perilipin 3 (PLN3) or TIP47, is a protein which in humans is encoded by the M6PRBP1 gene. Mannose 6-phophate receptors (MPRs) deliver lysosomal hydrolase from the Golgi to endosomes and then return to the Golgi complex. The protein encoded by this gene interacts with the cytoplasmic domains of both cation-independent and cation-dependent MPRs, and is required for endosome-to-Golgi transport. This protein also binds directly to the GTPase RAB9 (RAB9A), a member of the RAS oncogene family. The interaction with RAB9 has been shown to increase the affinity of this protein for its cargo. Multiple t |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Perilipin 3 (323-365aa ESRALTMFRDIAQQLQATCTSLGSSIQGLPTNVKDQVQQA RRQ), different from the related mouse sequence by fourteen amino acids. |
| Other Names | [M6PRBP 1; M6PRBP1; Perilipin 3; Perilipin3; Perilipin-3; PLIN3; pp17; Placental protein 17; TIP47; O60664; Perilipin-3; perilipin 3], [PLIN3; PLIN3; PP17; TIP47; M6PRBP1; M6PRBP1; TIP47; 47 kDa MPR-binding protein; PP17] |
| Gene, Accession # | [PLIN3], Gene ID: 10226, NCBI: NP_001157661.1, UniProt: O60664 |
| Catalog # | MBS178513 |
| Price | $315 |
| Order / More Info | Perilipin 3 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Entrez Gene: M6PRBP1 mannose-6-phosphate receptor binding protein 1.2. Bulankina AV, Deggerich A, Wenzel D, Mutenda K, Wittmann JG, Rudolph MG, Burger KN, Honing S (May 2009).TIP47 functions in the biogenesis of lipid droplets. J. Cell Biol. 185 (4): 641-55.3. Carroll KS, Hanna J, Simon I, Krise J, Barbero P, Pfeffer SR. (May 2001). Role of Rab9 GTPase in facilitating receptor recruitment by TIP47.. Science 292(5520): 1373-6. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies