Edit |   |
---|---|
Antigenic Specificity | Calsyntenin 1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 0.05 mg |
Concentration | 1 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Specificity: Calsyntenin 1 antibody was raised against the N terminal of CLSTN1. Rabbit polyclonal Calsyntenin 1 antibody raised against the N terminal of CLSTN1 |
Immunogen | Immunogen: Calsyntenin 1 antibody was raised using the N terminal of CLSTN1 corresponding to a region with amino acids KPWLEPTYHGIVTENDNTVLLDPPLIALDKDAPLRFAESFEVTVTKEGEI |
Other Names | [Calsyntenin 1; Calsyntenin 1; alcalpha1; CSTN1; CLSTN1; KIAA0911; PIK3CD; XB31alpha; FLJ32258; alcalpha2] |
Gene, Accession # | Gene ID: 22883, NCBI: AAH33902.1 |
Catalog # | MBS5302974 |
Price | $430 |
Order / More Info | Calsyntenin 1 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |