Edit |   |
---|---|
Antigenic Specificity | SLCO3A1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | affinity purified |
Size | 0.05 mg |
Concentration | 1 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Specificity: SLCO3A1 antibody was raised against the middle region of SLCO3A1. Rabbit polyclonal SLCO3A1 antibody raised against the middle region of SLCO3A1 |
Immunogen | Immunogen: SLCO3A1 antibody was raised using the middle region of SLCO3A1 corresponding to a region with amino acids MEIAVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLL |
Other Names | [SLCO3A1; SLCO3A1; OATP-D; SLCOA1 3; FLJ40478; SLCOA1-3; SLC21A11; SLCO3A1; Solute Carrier Organic Anion Transporter Family Member 3A1; OATP3A1] |
Gene, Accession # | [SLCO3A1] |
Catalog # | MBS5303015 |
Price | $430 |
Order / More Info | SLCO3A1 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |