IFNGR1 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-IFNGR1 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | IFNGR1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal antibody for Interferon gamma receptor 1(IFNGR1) detection. Background: Interferon gamma receptor 1 (IFNGR1), also known as CD119 (Cluster of Differentiation 119), is a protein that in humans is encoded by the IFNGR1 gene. This gene (IFNGR1) encodes the ligand-binding chain (alpha) of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. A genetic variation in IFNGR1 is associated with susceptibility to Helicobacter pylori infection. In addition, defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease, also known as familial disseminated atypical mycobacterial infection. |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human IFNGR1 (443-484aa QELITVIKAPTSFGYDKPHVLVDLLVDDSGKESLIGYRPTED), different from the related mouse sequence by seventeen amino acids. |
| Other Names | [CD 119; CD119; CDw119; IFN gamma R1; IFN-gamma-R1; IFNG R1; IFNGR 1; IFNGR; IFNGR1; IMD27A; IMD27B; P15260; Interferon gamma receptor 1], [IFNGR1; IFNGR1; CD119; IFNGR; IMD27A; IMD27B; IFN-gamma-R-alpha] |
| Gene, Accession # | [IFNGR1], Gene ID: 3459, NCBI: NP_000407.1, UniProt: P15260 |
| Catalog # | MBS178653 |
| Price | $315 |
| Order / More Info | IFNGR1 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Entrez Gene: IFNGR1 interferon gamma receptor 1.2. Aguet M, Dembi? Z, Merlin G (Oct 1988). Molecular cloning and expression of the human interferon-gamma receptor. Cell. 55 (2): 273-80.3. Novick D, Orchansky P, Revel M, Rubinstein M (Jun 1987). The human interferon-gamma receptor. Purification, characterization, and preparation of antibodies. The Journal of Biological Chemistry. 262(18): 8483-7. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies