Edit |   |
---|---|
Antigenic Specificity | SLC43A3 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | Protein A purified |
Size | 0.1 mg |
Concentration | 1 mg/ml |
Applications | Western Blot (WB), Immunohistochemistry (IHC) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Specificity: SLC43A3 antibody was raised against the N terminal of SLC43A3. Rabbit polyclonal SLC43A3 antibody raised against the N terminal of SLC43A3 |
Immunogen | Immunogen: SLC43A3 antibody was raised using the N terminal of SLC43A3 corresponding to a region with amino acids MAGQGLPLHVATLLTGLLECLGFAGVLFGWPSLVFVFKNEDYFKDLCGPD |
Other Names | [SLC43A3; SLC43A3; SLCA3-43; EEG1; FOAP-13; SLC43A3; DKFZp762A227; SLCA3 43; PRO1659; SEEEG-1; Solute Carrier Family 43 Member 3] |
Gene, Accession # | [SLC43A3], NCBI: CAG33672.1, UniProt: Q8NBI5 |
Catalog # | MBS5300257 |
Price | $355 |
Order / More Info | SLC43A3 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |