Human CCKBR Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-Human CCKBR antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Human CCKBR |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | DyLight 488 conjugate |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Flow Cytometry (FC/FACS) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Specificity: No cross reactivity with other proteins. The cholecystokinin B receptor, also known as CCKBR or CCK2, is a protein that in humans is encoded by the CCKBR gene. This gene encodes a G-protein coupled receptor for gastrin and cholecystokinin (CCK), regulatory peptides of the brain and gastrointestinal tract. This protein is a type B gastrin receptor, which has a high affinity for both sulfated and nonsulfated CCK analogs and is found principally in the central nervous system and the gastrointestinal tract. Alternative splicing results in multiple transcript variants. A misspliced transcript variant including an intron has been observed in cells from colorectal and pancreatic tumors. |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence of human CCKBR (PVYTVVQPVGPRVLQCVHRWPSARVRQTWS). |
| Other Names | [Rabbit IgG Human CCKBR DyLight 488 Conjugated, Flow Validated; Gastrin/cholecystokinin type B receptor; CCK-B receptor; CCK-BR; Cholecystokinin-2 receptor; CCK2-R; CCKBR; CCKRB; Cholecystokinin B receptor] |
| Gene, Accession # | [CCKBR], Gene ID: 887, NCBI: NP_001304958.1, UniProt: P32239 |
| Catalog # | MBS1751371 |
| Price | $330 |
| Order / More Info | Human CCKBR Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Altar CA, Boyar WC (Apr 1989). Brain CCK-B receptors mediate the suppression of dopamine release by cholecystokinin. Brain Research. 483 (2): 321-6. 2. Noble F, Roques BP (Jul 1999). CCK-B receptor: chemistry, molecular biology, biochemistry and pharmacology. Progress in Neurobiology. 58 (4): 349-79. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies