IL7R alpha Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-IL7R alpha antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | IL7R alpha |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, rat. |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal antibody for Interleukin-7 receptor subunit alpha (IL7R) detection. Background: The interleukin-7 receptor, also known as IL7R alpha, is a protein found on the surface of cells. It is mapped to 5p13. Interleukin-7 receptor has been shown to play a critical role in the development of immune cells called lymphocytes - specifically in a process known as V(D)J recombination. This protein is also found to control the accessibility of a region of the genome that contains the T-cell receptor gamma gene, by STAT5 and histone acetylation. Knockout studies in mice suggest that blocking apoptosis is an essential function of this protein during differentiation and activation of T lymphocytes. Functional defects in this protein may |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human IL7R alpha (278-315aa DHKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQ), different from the related mouse sequence by nine amino acids. |
| Other Names | [CD 127; CD127; CD127 antigen; IL 7R alpha; IL-7R-alpha; IL 7R; IL7R; IL-7RA; IL7RA; IL7Ralpha; ILRA; Interleukin 7 receptor; P16871; Interleukin-7 receptor subunit alpha; interleukin 7 receptor], [IL7R; IL7R; ILRA; CD127; IL7RA; CDW127; IL-7R-alpha; IL-7 receptor subunit alpha; IL-7R subunit alpha; IL-7R-alpha; IL-7RA] |
| Gene, Accession # | [IL7R], Gene ID: 3575, NCBI: NP_002176.2, UniProt: P16871 |
| Catalog # | MBS178448 |
| Price | $280 |
| Order / More Info | IL7R alpha Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Entrez Gene: IL7R interleukin 7 receptor.2. Kroemer RT, Richards WG (December 1996). Homology modeling study of the human interleukin-7 receptor complex.Protein Eng. 9 (12): 1135-42.3. O'Doherty C, Alloza I, Rooney M, Vandenbroeck K (November 2009). IL7RA polymorphisms and chronic inflammatory arthropathies. Tissue Antigens 74 (5): 429-31. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies