LOXL2 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-LOXL2 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | LOXL2 |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Lysyl oxidase homolog 2(LOXL2) detection. Tested with WB in Human;Mouse;Rat. Background: Lysyl oxidase homolog 2 is an enzyme that in humans is encoded by the LOXL2 gene. This gene encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional r |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human LOXL2 (739-770aa HRIWMYNCHIGGSFSEETEKKFEHFSGLLNNQ), different from the related mouse and rat sequences by four amino acids. Ig Type: Rabbit IgG |
| Other Names | [Lysyl oxidase homolog 2; LOR 2; LOR2; LOX L2; LOXL 2; LOXL2; LOXL2_HUMAN; Lysyl oxidase homolog 2; Lysyl oxidase like 2; Lysyl oxidase like protein 2; Lysyl oxidase related 2; Lysyl oxidase related protein 2; Lysyl oxidase related protein WS9 14; Lysyl oxidase-like protein 2; Lysyl oxidase-related protein 2; Lysyl oxidase-related protein WS9-14; WS9 14; lysyl oxidase-like 2], [LOXL2; LOXL2; LOR2; WS9-14] |
| Gene, Accession # | [LOXL2], Gene ID: 4017, NCBI: NP_002309.1, UniProt: Q9Y4K0 |
| Catalog # | MBS177930 |
| Price | $280 |
| Order / More Info | LOXL2 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Entrez Gene: LOXL2 lysyl oxidase-like 2. 2. Bignon M, Pichol-Thievend C, Hardouin J, Malbouyres M, Brechot N, Nasciutti L, Barret A, Teillon J, Guillon E, Etienne E, Caron M, Joubert-Caron R, Monnot C, Ruggiero F, Muller L, Germain S (2011). Lysyl oxidase-like protein-2 regulates sprouting angiogenesis and type IV collagen assembly in the endothelial basement membrane.Blood 118: 3979-89. 3. Jourdan-Le Saux C, Le Saux O, Donlon T, Boyd CD, Csiszar K (Jul 1998). The human lysyl oxidase-related gene (LOXL2) maps between markers D8S280 and D8S278 on chromosome 8p21.2-p21.3. Genomics 51 (2): 305-7. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies