Edit |   |
---|---|
Antigenic Specificity | C20orf132 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 0.05 mg |
Concentration | 1 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Specificity: C20orf132 antibody was raised against the middle region of C20orf132. Rabbit polyclonal C20orf132 antibody raised against the middle region of C20orf132 |
Immunogen | Immunogen: C20orf132 antibody was raised using the middle region of C20orf132 corresponding to a region with amino acids PHLENLDTIIKLPLRFQRLGHLVALMALLCGDPQEKVAEEAAEGIHSLLH |
Other Names | [C20orf132; C20orf132; Chromosome 20 Open Reading Frame 132; Chromosome 20 ORF; DKFZp434N0426; dJ621N11.4; Chromosome ORF-20; FLJ36113; Chromosome ORF 20], [MROH8; MROH8; C20orf131; C20orf132; dJ621N11.3; dJ621N11.4; C20orf131; C20orf132] |
Gene, Accession # | [C20orf132], Gene ID: 140699, NCBI: AAH30006.1 |
Catalog # | MBS839032 |
Price | $430 |
Order / More Info | C20orf132 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |