TCP1 alpha Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-TCP1 alpha antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | TCP1 alpha |
| Clone | [2E7] |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG1 |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Frozen/Paraffin, Immunocytochemistry (ICC), Flow Cytometry (FC/FACS) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Specificity: No cross reactivity with other proteins. Description: Mouse IgG monoclonal antibody for TCP1 alpha detection. Tested with WB, IHC-P, IHC-F, ICC, FCM in Human.Background: T-complex protein 1 subunit alpha is a protein that in humans is encoded by the TCP1 gene. The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice varia |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human TCP1 alpha (515-551aa KFATEAAITILRIDDLIKLHPESKDDKHGSYEDAVHS), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids. |
| Other Names | [T-complex protein 1 subunit alpha; TCP-1-alpha; CCT-alpha; TCP1; CCT1; CCTA; T-complex 1] |
| Gene, Accession # | [TCP1], Gene ID: 6950, NCBI: NP_110379.2, UniProt: P17987 |
| Catalog # | MBS1752202 |
| Price | $315 |
| Order / More Info | TCP1 alpha Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Entrez Gene: TCP1 t-complex 1. 2. Fonatsch C, Gradl G, Ragoussis J, Ziegler A (Oct 1987). Assignment of the TCP1 locus to the long arm of human chromosome 6 by in situ hybridization. Cytogenet Cell Genet 45 (2): 109-12. 3. Willison K, Kelly A, Dudley K, Goodfellow P, Spurr N, Groves V, Gorman P, Sheer D, Trowsdale J (Nov 1987).The human homologue of the mouse t-complex gene, TCP1, is located on chromosome 6 but is not near the HLA region. EMBO J 6 (7): 1967-74. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies