Edit |   |
---|---|
Antigenic Specificity | PABPC1L2A |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 0.05 mg |
Concentration | 1 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit polyclonal PABPC1L2A antibody |
Immunogen | Immunogen: PABPC1L2A antibody was raised using a synthetic peptide corresponding to a region with amino acids NGMFLNYRKIFVGRFKSHKEREAERGAWARQSTSADVKDFEEDTDEEATL |
Other Names | n/a |
Gene, Accession # | [PABPC1L2A] |
Catalog # | MBS839488 |
Price | $430 |
Order / More Info | PABPC1L2A Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |