Alpha Defensin 1 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-Alpha Defensin 1 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Alpha Defensin 1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal antibody for Neutrophil defensin 1(DEFA1) detection. Background: Defensin, alpha 1, also known as human alpha defensin 1, human neutrophil peptide 1 (HNP-1) or neutrophil defensin 1 is a human protein that is encoded by the DEFA1 gene. Defensins are a family of antimicrobial and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. The protein encoded by this gene, defensin, alpha 1, is found in the microbicidal granules |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Alpha Defensin 1 (65-94aa ACYCRIPACIAGERRYGTCIYQGRLWAFCC). |
| Other Names | [DEF1; DEFA1; DEFA1B; DEFA2; Defensin 1; Defensin; HNP-1; HNP-2; HNP1; HP-1; HP-2; HP1; HP2; MRS; P59665; Neutrophil defensin 1; defensin alpha 1], [DEFA1B; DEFA1; HP1; HP-1; HNP-1; DEF1; DEFA2; MRS; HP-1; HP1; HP-2; HP2] |
| Gene, Accession # | [DEFA1], Gene ID: 728358, NCBI: NP_001035965.1, UniProt: P59665 |
| Catalog # | MBS178711 |
| Price | $280 |
| Order / More Info | Alpha Defensin 1 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Entrez Gene: DEFA1 defensin, alpha 1.2. Aldred PM, Hollox EJ, Armour JA (Jul 2005). Copy number polymorphism and expression level variation of the human alpha-defensin genes DEFA1 and DEFA3.Hum Mol Genet. 14 (14): 2045-52.3. Feng Y, Gutekunst CA, Eberhart DE, Yi H, Warren ST, Hersch SM (Mar 1997). Fragile X mental retardation protein: nucleocytoplasmic shuttling and association with somatodendritic ribosomes. J Neurosci. 17 (5): 1539-47. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies