SULT2A1 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-SULT2A1 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | SULT2A1 |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Bile salt sulfotransferase(SULT2A1) detection. Tested with WB, IHC-P in Human;Mouse;Rat. Background: Bile salt sulfotransferase, also known as hydroxysteroid sulfotransferase (HST) or sulfotransferase 2A1 (ST2A1), is an enzyme that in humans is encoded by the SULT2A1 gene. It is mapped to 19q13.3. This gene encodes a member of the sulfotransferase family. Sulfotransferases aid in the metabolism of drugs and endogenous compounds by converting these substances into more hydrophilic water-soluble sulfate conjugates that can be easily excreted. This protein catalyzes the sulfation of steroids and bile acids in the liver and adrenal glands, and may have a role in the inherited adrenal androgen exce |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human SULT2A1 (253-285aa DWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE), different from the related mouse sequence by seven amino acids, and from the related rat sequence by eight amino acids. Ig Type: Rabbit IgG |
| Other Names | [Bile salt sulfotransferase; Alcohol/hydroxysteroid sulfotransferase; Bile salt sulfotranasferase 2A1; Bile salt sulfotransferase; Dehydroepiandrosterone sulfotransferase; DHEA ST; DHEA sulfotranasferase; DHEA-ST; DHEAS; EC 2.8.2.14; Hst; hSTa; Hydroxysteroid sulfotransferase; ST2; ST2A1; ST2A1_HUMAN; ST2A3; STD; sulfotranasferase, dehydroepiandrosterone-preferring; Sulfotransferase 2A1; Sulfotransferase family 2A, dehydroepiandrosterone-preferring, member 1; Sulfotransferase family cytosolic 2A dehydroepiandrosterone (DHEA) preferring member 1; Sult2a1; sulfotransferase family 2A member 1], [SULT2A1; SULT2A1; HST; ST2; STD; hSTa; DHEAS; ST2A1; ST2A3; DHEA-ST; HST; STD; DHEA-ST; HST; ST2A1] |
| Gene, Accession # | [SULT2A1], Gene ID: 6822, NCBI: NP_003158.2, UniProt: Q06520 |
| Catalog # | MBS177742 |
| Price | $315 |
| Order / More Info | SULT2A1 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Entrez Gene: SULT2A1 sulfotransferase family, cytosolic, 2A, dehydroepiandrosterone (DHEA)-preferring, member 1. 2. Otterness DM, Wieben ED, Wood TC, Watson WG, Madden BJ, McCormick DJ, Weinshilboum RM (May 1992). Human liver dehydroepiandrosterone sulfotransferase: molecular cloning and expression of cDNA. Mol. Pharmacol. 41(5): 865-72. 3. Otterness DM, Mohrenweiser HW, Brandriff BF, Weinshilboum RM (1995). Dehydroepiandrosterone sulfotransferase gene (STD): localization to human chromosome band 19q13.3. Cytogenet. Cell Genet. 70 (1-2): 45-7. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies