Exportin-5 Picoband Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-Exportin-5 Picoband antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Exportin-5 Picoband |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Exportin-5 (XPO5) is a protein that in humans is encoded by the XPO5 gene. The International Radiation Hybrid Mapping Consortium mapped the XPO5 gene to chromosome 6. This gene encodes a member of the karyopherin family that is required for the transport of small RNAs and double-stranded RNA-binding proteins from the nucleus to the cytoplasm. The encoded protein translocates cargo through the nuclear pore complex in a RanGTP-dependent process.Protein Function: Mediates the nuclear export of proteins bearing a double-stranded RNA binding domain (dsRBD) and double-stranded RNAs (cargos). XPO5 in the nucleus binds cooperatively to the RNA and to the GTPase Ran in its active GTP-bound form. Proteins containing dsRBDs can associ |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Exportin-5 (2-43aa AMDQVNALCEQLVKAVTVMMDPNSTQRYRLEALKFCEEFKEK), different from the related mouse sequence by four amino acids. Subcellular Localization: Nucleus. Cytoplasm. Shuttles between the nucleus and the cytoplasm. Tissue Specificity: Expressed in heart, brain, placenta, lung, skeletal muscle, kidney and pancreas. |
| Other Names | [Exportin-5; Exp5; Ran-binding protein 21; XPO5; KIAA1291; RANBP21] |
| Gene, Accession # | [XPO5], Gene ID: 57510, NCBI: NP_065801.1, UniProt: Q9HAV4 |
| Catalog # | MBS1750797 |
| Price | $280 |
| Order / More Info | Exportin-5 Picoband Antibody from MYBIOSOURCE INC. |
| Product Specific References | n/a |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies