Edit |   |
---|---|
Antigenic Specificity | SLC1A3 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | affinity purified |
Size | 0.1 mL |
Concentration | 2.6 mg/ml |
Applications | Western Blot (WB), Immunohistochemistry (IHC) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | This gene encodes a member of a member of a high affinity glutamate transporter family. This gene functions in the termination of excitatory neurotransmission in central nervous system. Mutations are associated with episodic ataxia, Type 6. Alternative splicing results in multiple transcript variants. |
Immunogen | Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 453-542 of human SLC1A3 (NP 004163.3). Immunogen Sequence: IVLTSVGLPTDDITLIIAVDWFLDRLRTTTNVLGDSLGAGIVEHLSRHELKNRDVEMGNSVIEENEMKKPYQLIAQDNETEKPIDSETKM |
Other Names | [SLC1A3; EA6; EAAT1; GLAST; GLAST1; solute carrier family 1 member 3] |
Gene, Accession # | [SLC1A3], Gene ID: 6507, NCBI: NP_001276868.1, UniProt: P43003 |
Catalog # | MBS9140453 |
Price | $260 |
Order / More Info | SLC1A3 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |