Edit |   |
---|---|
Antigenic Specificity | ADARB2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 0.05 mg |
Concentration | 1 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit polyclonal ADARB2 antibody |
Immunogen | Immunogen: ADARB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SYRHNRPLLSGVSDAEARQPGKSPPFSMNWVVGSADLEIINATTGRRSCG |
Other Names | [ADARB2; ADARB2; Adenosine Deaminase Rna-Specific B2; FLJ36975; hRED2; ADAR3; FLJ25034; RED2; RED2 homolog] |
Gene, Accession # | [ADARB2], Gene ID: 105, NCBI: AAI39726.1 |
Catalog # | MBS5300659 |
Price | $430 |
Order / More Info | ADARB2 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |