Edit |   |
---|---|
Antigenic Specificity | C1ORF190 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 0.05 mg |
Concentration | 1 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Specificity: C1ORF190 antibody was raised against the middle region of C1Orf190. Rabbit polyclonal C1ORF190 antibody raised against the middle region of C1Orf190 |
Immunogen | Immunogen: C1ORF190 antibody was raised using the middle region of C1Orf190 corresponding to a region with amino acids SIGSFLDTVAPSELDEQGPPGAPRSEMDWAKVIAGGERARTEVDVAATRL |
Other Names | [C1ORF190; C1ORF190; Chromosome 1 ORF; Chromosome ORF-1; Chromosome ORF 1; FLJ25163], [LURAP1; LURAP1; LRP35A; LRAP35a; C1orf190; C1orf190; LRAP35A; LRP35A] |
Gene, Accession # | [C1ORF190], Gene ID: 541468, NCBI: EAX06931.1 |
Catalog # | MBS839758 |
Price | $430 |
Order / More Info | C1ORF190 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |