Beta III Tubulin Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-Beta III Tubulin antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Beta III Tubulin |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal antibody for Tubulin beta-3 chain(TUBB3) detection. Background: Tubulin beta-3 chain is a protein that in humans is encoded by the TUBB3 gene. This gene encodes a class III member of the beta tubulin protein family. Beta tubulins are one of two core protein families (alpha and beta tubulins) that heterodimerize and assemble to form microtubules. This protein is primarily expressed in neurons and may be involved in neurogenesis and axon guidance and maintenance. Mutations in this gene are the cause of congenital fibrosis of the extraocular muscles type 3. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 6. |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Beta III Tubulin (383-412aa EQFTAMFRRKAFLHWYTGEGMDEMEFTEAE), identical to the related mouse and rat sequences. |
| Other Names | [beta 3 tubulin; beta-4; CDCBM; CDCBM1; CFEOM3A; CFEOM3; FEOM3; M(beta)3; M(beta)6; MC1R; Tubb 3; TUBB3; TUBB4; Tubulin beta 3; Tubulin beta 3 chain; Tubulin beta 4; Tubulin beta-4 chain; Tubulin beta III; Tubulin beta-III; Q13509; tubulin beta 3 class III], [TUBB3; TUBB3; CDCBM; FEOM3; TUBB4; CDCBM1; CFEOM3; beta-4; CFEOM3A; TUBB4] |
| Gene, Accession # | [TUBB3], Gene ID: 10381, NCBI: NP_001184110.1, UniProt: Q13509 |
| Catalog # | MBS178655 |
| Price | $315 |
| Order / More Info | Beta III Tubulin Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Ranganathan S, Dexter DW, Benetatos CA, Hudes GR (Mar 1998). Cloning and sequencing of human betaIII-tubulin cDNA: induction of betaIII isotype in human prostate carcinoma cells by acute exposure to antimicrotubule agents. Biochim Biophys Acta. 1395 (2): 237-45.2. Cicchillitti L, Penci R, Di Michele M, Filippetti F, Rotilio D, Donati MB, Scambia G, Ferlini C (July 2008). |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies