DGAT1 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-DGAT1 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | DGAT1 |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Diacylglycerol O-acyltransferase 1(DGAT1) detection. Tested with WB in Human;Rat. Background: Acyl-CoA: diacylglycerol acyltransferase (DGAT) is a microsomal enzyme that plays a central role in the metabolism of cellular diacylglycerol lipids and catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol (DAG) and fatty acyl CoA as substrates. DGAT had been considered necessary for adipose tissue formation and essential for survival. There are two isozymes of DGAT encoded by the genes DGAT1 and DGAT2. DGAT1 is a host factor for HCV infection that binds core protein, localizes it to DGAT1-generated lipid droplets, and recruits viral RNA replication compl |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human DGAT1 (280-318aa RRILEMLFFTQLQVGLIQQWMVPTIQNSMKPFKDMDYSR), different from the related mouse and rat sequences by one amino acid. Ig Type: Rabbit IgG |
| Other Names | [Diacylglycerol O-acyltransferase 1; ACAT related gene product 1; ACAT-related gene product 1; Acyl coenzyme A:cholesterol acyltransferase related gene 1; Acyl-CoA retinol O-fatty-acyltransferase; Acyl-CoA:diacylglycerol acyltransferase; ARAT; ARGP1; C75990; D15Ertd23e; Dgat; DGAT1; DGAT1_HUMAN; Diacylglycerol O acyltransferase 1; Diacylglycerol O-acyltransferase 1; DIAR7; Diglyceride acyltransferase; EC 2.3.1.20; hCG_24006; MGC139064; Retinol O fatty acyltransferase; diacylglycerol O-acyltransferase 1], [DGAT1; DGAT1; ARAT; DGAT; ARGP1; DIAR7; AGRP1; DGAT; ARAT; Retinol O-fatty-acyltransferase] |
| Gene, Accession # | [DGAT1], Gene ID: 8694, NCBI: NP_036211.2, UniProt: O75907 |
| Catalog # | MBS178380 |
| Price | $280 |
| Order / More Info | DGAT1 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Cases, S., Smith, S. J., Zheng, Y.-W., Myers, H. M., Lear, S. R., Sande, E., Novak, S., Collins, C., Welch, C. B., Lusis, A. J., Erickson, S. K., Farese, R. V., Jr. Identification of a gene encoding an acyl CoA:diacylglycerol acyltransferase, a key enzyme in triacylglycerol synthesis. Proc. Nat. Acad. Sci. 95: 13018-13023, 1998. 2. Cheng D, Iqbal J, Devenny J, Chu CH, Chen L, Dong J, Seethala R, Keim WJ, Azzara AV, Lawrence RM, Pelleymounter MA, Hussain MM (October 2008).Acylation of acylglycerols by acyl coenzyme A:diacylglycerol acyltransferase 1 (DGAT1). Functional importance of DGAT1 in the intestinal fat absorption. J. Biol. Chem. 283 (44): 29802-11. 3. Herker, E., Harris, C., Hernandez, C., Carpentier, A., Kaehlcke, K., Rosenberg, A. R., Farese, R. V., Jr., Ott, M. Efficient hepatitis C virus particle formation requires diacylglycerol acyltransferase-1. Nature Med. 16: 1295-1298, 2010. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies