Edit |   |
---|---|
Antigenic Specificity | BRD2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | affinity purified |
Size | 0.1 mL |
Concentration | 3.29 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | This gene encodes a transcriptional regulator that belongs to the BET (bromodomains and extra terminal domain) family of proteins. This protein associates with transcription complexes and with acetylated chromatin during mitosis, and it selectively binds to the acetylated lysine-12 residue of histone H4 via its two bromodomains. The gene maps to the major histocompatability complex (MHC) class II region on chromosome 6p21.3, but sequence comparison suggests that the protein is not involved in the immune response. This gene has been implicated in juvenile myoclonic epilepsy, a common form of epilepsy that becomes apparent in adolescence. Multiple alternatively spliced variants have been described for this gene. |
Immunogen | Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human BRD2 (NP 001186385.1). Immunogen Sequence: MASVPALQLTPANPPPPEVSNPKKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNT |
Other Names | [BRD2; BRD2-IT1; D6S113E; FSH; FSRG1; NAT; O27.1.1; RING3; RNF3; bromodomain containing 2] |
Gene, Accession # | [BRD2], Gene ID: 6046, NCBI: NP_001106653.1, UniProt: P25440 |
Catalog # | MBS9140787 |
Price | $260 |
Order / More Info | BRD2 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |