Edit |   |
---|---|
Antigenic Specificity | STARD4 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | mouse, rat |
Isotype | n/a |
Format | affinity purified |
Size | 0.1 mL |
Concentration | 3.18 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Cholesterol homeostasis is regulated, at least in part, by sterol regulatory element (SRE)-binding proteins (e.g., SREBP1; MIM 184756) and by liver X receptors (e.g., LXRA; MIM 602423). Upon sterol depletion, LXRs are inactive and SREBPs are cleaved, after which they bind promoter SREs and activate genes involved in cholesterol biosynthesis and uptake. Sterol transport is mediated by vesicles or by soluble protein carriers, such as steroidogenic acute regulatory protein (STAR; MIM 600617). STAR is homologous to a family of proteins containing a 200- to 210-amino acid STAR-related lipid transfer (START) domain, including STARD4 (Soccio et al., 2002 [PubMed 12011452]). |
Immunogen | Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human STARD4 (NP 001294986.1). Immunogen Sequence: MEGLSDVASFATKLKNTLIQYHSIEEDKWRVAKKTKDVTVWRKPSEEFNGYLYKAQGVIDDLVYSIIDHIRPGPCRLDWDSLMTSLDILENFEENCCVMR |
Other Names | [STARD4; stAR-related lipid transfer protein 4] |
Gene, Accession # | [STARD4], Gene ID: 134429, NCBI: NP_631903.1, UniProt: Q96DR4 |
Catalog # | MBS9140646 |
Price | $260 |
Order / More Info | STARD4 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |