Edit |   |
---|---|
Antigenic Specificity | PPP1R12A |
Clone | polyclonal |
Host Species | n/a |
Reactive Species | human, mouse |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 0.1 mg |
Concentration | n/a |
Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Description: Rabbit IgG polyclonal antibody for Protein phosphatase 1 regulatory subunit 12A(PPP1R12A) detection. Tested with WB, IHC-P in Human;Mouse. Background: PPP1R12A (Protein phosphatase 1 regulatory subunit 12A), also called MYPT1 (Myosin phosphatase target subunit 1), is an enzyme that in humans is encoded by the PPP1R12A gene. PPP1R12A is one of the subunits of myosin phosphatase. Sequencing analysis showed that human PPP1R12A contains 1,030 amino acids with a calculated molecular mass of approximately 115 kD. The PPP1R12A gene is mapped on 12q21.2-q21.3. PPP1R12A is the protein that regulates PP1 function in smooth muscle relaxation. The cellular MYPT1-PP1-delta -specific inhibitor CPI17 caused a loss of merlin function character |
Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human PPP1R12A (1-40aa MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFDD), identical to the related mouse and rat sequences. Ig Type: Rabbit IgG |
Other Names | [Protein phosphatase 1 regulatory subunit 12A; M130; MBS; MGC133042; Myosin binding subunit; Myosin phosphatase target subunit 1; Myosin phosphatase targeting subunit 1; Myosin phosphatase-targeting subunit 1; MYPT 1; MYPT1; MYPT1_HUMAN; PPP1R12A; Protein phosphatase 1 regulatory inhibitor subunit 12A; Protein phosphatase 1 regulatory subunit 12A; Protein phosphatase 1, regulatory (inhibitor) subunit 12A; Protein phosphatase myosin binding subunit; Protein phosphatase myosin-binding subunit; protein phosphatase 1, regulatory subunit 12A], [PPP1R12A; PPP1R12A; MBS; M130; MYPT1; MBS; MYPT1; Myosin phosphatase target subunit 1] |
Gene, Accession # | [PPP1R12A], Gene ID: 4659, NCBI: NP_001137357.1, UniProt: O14974 |
Catalog # | MBS177838 |
Price | $315 |
Order / More Info | PPP1R12A Antibody from MYBIOSOURCE INC. |
Product Specific References | 1. Kimura, K., Ito, M., Amano, M., Chihara, K., Fukata, Y., Nakafuku, M., Yamamori, B., Feng, J., Nakano, T., Okawa, K., Iwamatsu, A., Kaibuchi, K. Regulation of myosin phosphatase by Rho and Rho-associated kinase (Rho-kinase). Science 273: 245-248, 1996. 2. Takahashi, N., Ito, M., Tanaka, J., Nakano, T., Kaibuchi, K., Odai, H., Takemura, K. Localization of the gene coding for myosin phosphatase, target subunit 1 (MYPT1) to human chromosome 12q15-q21. Genomics 44: 150-152, 1997. |