SHANK3 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-SHANK3 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | SHANK3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse, rat. predicted to work with: human. |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal antibody for SH3 and multiple ankyrin repeat domains protein 3 (SHANK3) detection. Background: SH3 and multiple ankyrin repeat domains 3 (Shank3), also known as proline-rich synapse-associated protein 2 (ProSAP2), is a protein that in humans is encoded by the SHANK3 gene. This gene is a member of the Shank gene family. Shank proteins are multidomain scaffold proteins of the postsynaptic density that connect neurotransmitter receptors, ion channels, and other membrane proteins to the actin cytoskeleton and G-protein-coupled signaling pathways. Additionally, Shank proteins play a role in synapse formation and dendritic spine maturation. Mutations in this gene are a cause of autism spectrum disorder (ASD), which is charac |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human SHANK3 (1670-1710aa KFDVGDWLESIHLGEHRDRFEDHEIEGAHLPALTKDDFV EL), different from the related mouse and rat sequences by one amino acid. |
| Other Names | [KIAA1650; ProSAP2; PSAP2; Shank3; Shank3b; SPANK 2; SPANK2; Q9BYB0; SH3 and multiple ankyrin repeat domains protein 3; SH3 and multiple ankyrin repeat domains 3], [SHANK3; SHANK3; PSAP2; SCZD15; PROSAP2; SPANK-2; DEL22q13.3; KIAA1650; PROSAP2; PSAP2; Shank3; ProSAP2] |
| Gene, Accession # | [SHANK3], Gene ID: 85358, NCBI: NP_277052.1, UniProt: Q9BYB0 |
| Catalog # | MBS178411 |
| Price | $280 |
| Order / More Info | SHANK3 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Entrez Gene: SHANK3 SH3 and multiple ankyrin repeat domains 3.2. Boeckers TM, Bockmann J, Kreutz MR, Gundelfinger ED (2002). ProSAP/Shank proteins - a family of higher order organizing molecules of the postsynaptic density with an emerging role in human neurological disease.J. Neurochem. 81 (5): 903-10. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies