EBP1 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-EBP1 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | EBP1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal antibody for Proliferation-associated protein 2G4(PA2G4) detection. Background: Proliferation-associated protein 2G4 (PA2G4), also known as ErbB3-binding protein 1 (EBP1), is a protein that in humans is encoded by the PA2G4 gene. This gene encodes an RNA-binding protein that is involved in growth regulation. This protein is present in pre-ribosomal ribonucleoprotein complexes and may be involved in ribosome assembly and the regulation of intermediate and late steps of rRNA processing. This protein can interact with the cytoplasmic domain of the ErbB3 receptor and may contribute to transducing growth regulatory signals. This protein is also a transcriptional corepressor of androgen receptor-regulated genes and other cel |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human EBP1 (138-178aa RKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFN), identical to the related mouse and rat sequences. |
| Other Names | [hG4 1; hG4-1; Mpp1; p38 2G4; Pa2g4; Plfap; Q9UQ80; Proliferation-associated protein 2G4; proliferation-associated 2G4], [PA2G4; PA2G4; EBP1; HG4-1; p38-2G4; EBP1; hG4-1] |
| Gene, Accession # | [PA2G4], Gene ID: 5036, NCBI: NP_006182.2, UniProt: Q9UQ80 |
| Catalog # | MBS178670 |
| Price | $315 |
| Order / More Info | EBP1 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Lamartine J, Seri M, Cinti R, Heitzmann F, Creaven M, Radomski N, Jost E, Lenoir GM, Romeo G, Sylla BS (November 1997). Molecular cloning and mapping of a human cDNA (PA2G4) that encodes a protein highly homologous to the mouse cell cycle protein p38-2G4. Cytogenet Cell Genet. 78 (1): 31-5.2. Entrez Gene: PA2G4 proliferation-associated 2G4, 38kDa. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies