Chk2 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-Chk2 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Chk2 |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Serine/threonine-protein kinase Chk2(CHEK2) detection. Tested with WB, IHC-P in Human;Mouse;Rat. Background: CHK2, a protein kinase that is activated in response to DNA damage, is involved in cell cycle arrest. Mapped on 22q12.1, CHK2 has a potential regulatory region rich in SQ and TQ amino acid pairs. It regulates BRCA1 function after DNA damage by phosphorylating serine-988 of BRCA1. Additionally, CHK2 can be modified by phosphorylation and activated in response to ionizing radiation, and can be also modified in response to hydroxyurea treatment. Furthermore, oligomerization of CHEK2 increases the efficiency of transautophosphorylation, resulting in the release of active CHEK2 monomers that |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Chk2 (465-498aa KLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDL), different from the related mouse sequence by four amino acids. Ig Type: Rabbit IgG |
| Other Names | [Serine/threonine-protein kinase Chk2; bA444G7; CDS 1; CDS1; Checkpoint kinase 2; Checkpoint like protein CHK2; Chek 2; Chek2; Chk 2; CHK2 checkpoint homolog (S. pombe); CHK2 checkpoint homolog; CHK2_HUMAN; HuCds 1; HuCds1; LFS 2; LFS2; PP1425; RAD 53; RAD53; Rad53 homolog; Serine/threonine protein kinase Chk2; Serine/ threonine-protein kinase Chk2; checkpoint kinase 2], [CHEK2; CHEK2; CDS1; CHK2; LFS2; RAD53; hCds1; HuCds1; PP1425; CDS1; CHK2; RAD53; Hucds1; hCds1] |
| Gene, Accession # | [Chk2], Gene ID: 11200, NCBI: NP_001005735.1, UniProt: O96017 |
| Catalog # | MBS177969 |
| Price | $315 |
| Order / More Info | Chk2 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Ahn, J.-Y.; Li, X.; Davis, H. L.; Canman, C. E. : Phosphorylation of threonine 68 promotes oligomerization and autophosphorylation of the Chk2 protein kinase via the forkhead-associated domain. J. Biol. Chem. 277: 19389-19395, 2002. 2. Bell, D. W.; Varley, J. M.; Szydlo, T. E.; Kang, D. H.; Wahrer, D. C. R.; Shannon, K. E.; Lubratovich, M.; Verselis, S. J.; Isselbacher, K. J.; Fraumeni, J. F.; Birch, J. M.; Li, F. P.; Garber, J. E.; Haber, D. A. : Heterozygous germ line hCHK2 mutations in Li-Fraumeni syndrome. Science 286: 2528-2531, 1999. 3. Brown, A. L.; Lee, C.-H.; Schwarz, J. K.; Mitiku, N.; Piwnica-Worms, H.; Chung, J. H. : A human Cds1-related kinase that functions downstream of ATM protein in the cellular response to DNA damage. Proc. Nat. Acad. Sci. 96: 3745-3750, 1999. 4. Lee, J.-S.; Collins, K. M.; Brown, A. L.; Lee, C.-H.; Chung, J. H. : hCds1-mediated phosphorylation of BRCA1 regulates the DNA damage response. Nature 404: 201-204, 2000. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies