GRK3 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-GRK3 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | GRK3 |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Beta-adrenergic receptor kinase 2(ADRBK2) detection. Tested with WB in Human. Background: Beta-adrenergic receptor kinase 2 (beta-ARK-2), also known as G-protein-coupled receptor kinase 3 (GRK3), is an enzyme that in humans is encoded by the ADRBK2 gene. The human ADRBK2 gene is located on 22q11. The beta-adrenergic receptor kinase specifically phosphorylates the agonist-occupied form of the beta-adrenergic and related G protein-coupled receptors. Overall, the beta adrenergic receptor kinase 2 has 85% amino acid similarity with beta adrenergic receptor kinase 1, with the protein kinase catalytic domain having 95% similarity. These data suggest the existence of a family of receptor kinases whic |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human GRK3 (635-669aa ESDPEFVQWKKELNETFKEAQRLLRRAPKFLNKPR), different from the related mouse and rat sequences by five amino acids. Ig Type: Rabbit IgG |
| Other Names | [Beta-adrenergic receptor kinase 2; ADRBK2; Adrenergic, beta, receptor kinase 2; ARBK2_HUMAN; BARK2; Beta adrenergic receptor kinase 2; Beta ARK 2; Beta-adrenergic receptor kinase 2; Beta-ARK-2; EC 2.7.11.15; G protein coupled receptor kinase 3; G-protein-coupled receptor kinase 3; GRK3; adrenergic, beta, receptor kinase 2], [ADRBK2; ADRBK2; GRK3; BARK2; BARK2; GRK3; Beta-ARK-2] |
| Gene, Accession # | [GRK3], Gene ID: 157, NCBI: NP_005151.2, UniProt: P35626 |
| Catalog # | MBS177971 |
| Price | $280 |
| Order / More Info | GRK3 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Benovic, J. L., Onorato, J. J., Arriza, J. L., Stone, W. C., Lohse, M., Jenkins, N. A., Gilbert, D. J., Copeland, N. G., Caron, M. G., Lefkowitz, R. J. Cloning, expression, and chromosomal localization of beta-adrenergic receptor kinase 2: a new member of the receptor kinase family. J. Biol. Chem. 266: 14939-14946, 1991. 2. Calabrese G, Sallese M, Stornaiuolo A, Stuppia L, Palka G, De Blasi A (Feb 1995). Chromosome mapping of the human arrestin (SAG), beta-arrestin 2 (ARRB2), and beta-adrenergic receptor kinase 2 (ADRBK2) genes. Genomics 23 (1): 286-8. 3. Parruti, G., Ambrosini, G., Sallese, M., De Blasi, A. Molecular cloning, functional expression and mRNA analysis of human beta-adrenergic receptor kinase 2. Biochem. Biophys. Res. Commun. 190: 475-481, 1993. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies