Edit |   |
---|---|
Antigenic Specificity | PB |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | Drosophila |
Isotype | n/a |
Format | affinity purified |
Size | 0.05 mg |
Concentration | 1 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Specificity: PB antibody was raised against the middle region of Pb. Rabbit polyclonal PB antibody raised against the middle region of Pb |
Immunogen | Immunogen: PB antibody was raised using the middle region of Pb corresponding to a region with amino acids DLTERQVKVWFQNRRMKHKRQTLSKTDDEDNKDSLKGDDDQSDSNSNSKK |
Other Names | [PB; PB; pd; Dmel_CG31481; PB; CG31481; l(3)04498], [Pbsn; Pbsn; PB; Prbs; PB] |
Gene, Accession # | [PB], Gene ID: 54193, NCBI: NP_061998.1 |
Catalog # | MBS839577 |
Price | $430 |
Order / More Info | PB Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |