Edit |   |
---|---|
Antigenic Specificity | APOBEC1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | mouse |
Isotype | n/a |
Format | affinity purified |
Size | 0.1 mL |
Concentration | 3.14 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | This gene encodes a member of the cytidine deaminase enzyme family. The encoded protein forms a multiple-protein editing holoenzyme with APOBEC1 complementation factor (ACF) and APOBEC1 stimulating protein (ASP). This holoenzyme is involved in the editing of C-to-U nucleotide bases in apolipoprotein B and neurofibromatosis-1 mRNAs. Multiple transcript variants encoding different isoforms have been found for this gene. |
Immunogen | Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human APOBEC1 (NP 001291495). Immunogen Sequence: MTSEKGPSTGDPTLRRRIEPWEFDVFYDPRELRKEACLLYEIKWGMSRKIWRSSGKNTTNHVEVNFIKKFTSERDFHPSM |
Other Names | [APOBEC1; APOBEC-1; BEDP; CDAR1; HEPR; C->U-editing enzyme APOBEC-1] |
Gene, Accession # | [APOBEC1], Gene ID: 339, NCBI: AAI01974.1, UniProt: P41238 |
Catalog # | MBS9140983 |
Price | $260 |
Order / More Info | APOBEC1 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |