JNK2 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-JNK2 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | JNK2 |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Mitogen-activated protein kinase 9(MAPK9) detection. Tested with WB in Human. Background: JNK2 is also known as MAPK9. The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase targets specific transcription factors, and thus mediates immediate-early gene expression in response to various cell stimuli. It is most closely related to MAPK8, both of which are involved in UV radiation induced apoptosis, thought to be related to the cytochrome c-mediated cell death |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human JNK2 (257-288aa RNYVENRPKYPGIKFEELFPDWIFPSESERDK), identical to the related mouse and rat sequences. Ig Type: Rabbit IgG |
| Other Names | [Mitogen-activated protein kinase 9; c Jun kinase 2; C Jun N terminal kinase 2; c-Jun N-terminal kinase 2; JNK 55; JNK-55; JNK2 alpha; JNK2; JNK2 beta; JNK2A; JNK2alpha; JNK2B; JNK2BETA; Jun kinase; MAP kinase 9; MAPK 9; Mapk9; Mitogen activated protein kinase 9; Mitogen-activated protein kinase 9; MK09_HUMAN; P54a; p54aSAPK; PRKM9; SAPK alpha; SAPK; SAPK1a; Stress activated protein kinase 1a; Stress-activated protein kinase JNK2; mitogen-activated protein kinase 9], [MAPK9; MAPK9; JNK2; SAPK; p54a; JNK2A; JNK2B; PRKM9; JNK-55; SAPK1a; JNK2BETA; p54aSAPK; JNK2ALPHA; JNK2; PRKM9; SAPK1A; MAP kinase 9; MAPK 9; SAPK1a] |
| Gene, Accession # | [JNK2], Gene ID: 5601, NCBI: NP_001128516.1, UniProt: P45984 |
| Catalog # | MBS178157 |
| Price | $280 |
| Order / More Info | JNK2 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Raciti M; Lotti LV; Valia S; Pulcinelli FM; Di Renzo L. JNK2 is activated during ER stress and promotes cell survival. Cell Death Dis, 2012 Nov 22. 2. Wang P; Xiong Y; Ma C; Shi T; Ma D. Molecular cloning and characterization of novel human JNK2 (MAPK9) transcript variants that show different stimulation activities on AP-1. BMB Rep, 2010 Nov. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies