CD229/LY9 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-CD229/LY9 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | CD229/LY9 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Immunohistochemistry (IHC) Frozen/Paraffin, Immunocytochemistry (ICC), Flow Cytometry (FC/FACS) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Specificity: No cross reactivity with other proteins. Description: Rabbit IgG polyclonal antibody for CD229/LY9 detection. Tested with IHC-P, IHC-F, ICC, FCM in Human; Mouse; Rat.Background: T-lymphocyte surface antigen Ly-9 is a protein that in humans is encoded by the LY9 gene. This gene is mapped to 17q21.31. LY9 has also recently been designated CD229 (cluster of differentiation 229). LY9 belongs to the SLAM family of immunomodulatory receptors and interacts with the adaptor molecule SAP. |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence of human CD229/LY9 (YKAQINQRNFEVTTEEEFTLFVYEQLQEPQVTMK). |
| Other Names | [T-lymphocyte surface antigen Ly-9; Cell surface molecule Ly-9; Lymphocyte antigen 9; SLAM family member 3; SLAMF3; Signaling lymphocytic activation molecule 3; CD229; LY9; CDABP0070; Lymphocyte antigen 9] |
| Gene, Accession # | [CD229], Gene ID: 4063, NCBI: NP_001028839.1, UniProt: Q9HBG7 |
| Catalog # | MBS1751494 |
| Price | $315 |
| Order / More Info | CD229/LY9 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Sandrin MS, Henning MM, Lo MF, Baker E, Sutherland GR, McKenzie IF (Feb 1996). Isolation and characterization of cDNA clones for Humly9: the human homologue of mouse Ly9. Immunogenetics. 2. Kingsmore SF, Souryal CA, Watson ML, Patel DD, Seldin MF (Aug 1995). Physical and genetic linkage of the genes encoding Ly-9 and CD48 on mouse and human chromosomes 1. Immunogenetics. 3. Entrez Gene: LY9 lymphocyte antigen 9. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies