SLC12A1 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-SLC12A1 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | SLC12A1 |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Solute carrier family 12 member 1(SLC12A1) detection. Tested with WB, IHC-P in Human;Mouse;Rat. Background: Solute carrier family 12 (sodium/potassium/chloride transporters), member 1, also called NKCC2 is specifically found in cells of the thick ascending limb of the loop of Henle in nephrons, the basic functional units of the kidney. This gene is mapped to 15q21.1. This gene encodes a kidney-specific sodium-potassium-chloride cotransporter that is expressed on the luminal membrane of renal epithelial cells of the thick ascending limb of Henle's loop and the macula densa. It plays a key role in concentrating urine and accounts for most of the NaCl resorption. It is sensitive to such diuretics |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human SLC12A1(52-83aa DEAQKRLRISFRPGNQECYDNFLQSGETAKTD), different from the related mouse sequence by two amino acids, and from the related rat sequence by four amino acids. Ig Type: Rabbit IgG |
| Other Names | [Solute carrier family 12 member 1; BSC1; Bumetanide sensitive sodium 3; Bumetanide-sensitive sodium-(potassium)-chloride cotransporter 2; Kidney specific Na K Cl symporter; Kidney-specific Na-K-Cl symporter; MGC48843; Na K 2Cl cotransporter; NKCC2; potassiumchloride cotransporter 2; S12A1_HUMAN; Slc12a1; sodium potassium chloride cotransporter 2; solute carrier family 12 (sodium/potassium/chloride transporters); Solute carrier family 12 member 1; solute carrier family 12 (sodium/potassium/chloride transporters), member 1], [SLC12A1; SLC12A1; BSC1; NKCC2; NKCC2] |
| Gene, Accession # | [SLC12A1], Gene ID: 6557, NCBI: NP_000329.2, UniProt: Q13621 |
| Catalog # | MBS177687 |
| Price | $315 |
| Order / More Info | SLC12A1 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Nozu, K., Iijima, K., Kawai, K., Nozu, Y., Nishida, A., Takeshima, Y., Fu, X. J., Hashimura, Y., Kaito, H., Nakanishi, K., Yoshikawa, N., Matsuo, M. In vivo and in vitro splicing assay of SLC12A1 in an antenatal salt-losing tubulopathy patient with an intronic mutation. Hum. Genet. 126: 533-538, 2009. 2. Takahashi, N., Chernavvsky, D. R., Gomez, R. A., Igarashi, P., Gitelman, H. J., Smithies, O.Uncompensated polyuria in a mouse model of Bartter's syndrome. Proc. Nat. Acad. Sci. 97: 5434-5439, 2000. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies