Edit |   |
---|---|
Antigenic Specificity | PLP2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, dog |
Isotype | n/a |
Format | Protein A purified |
Size | 0.1 mg |
Concentration | 1 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit polyclonal PLP2 antibody |
Immunogen | Immunogen: PLP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVERGNHSKIVAGVLGLIATCLFGYDAYVTFPVRQPRHTAAPTDPADGPV |
Other Names | n/a |
Gene, Accession # | [PLP2] |
Catalog # | MBS839447 |
Price | $355 |
Order / More Info | PLP2 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |