MAdCAM1 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-MAdCAM1 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | MAdCAM1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Specificity: No cross reactivity with other proteins. Description: Rabbit IgG polyclonal antibody for MAdCAM1 detection. Tested with WB in Human.Background: MADCAM1 (Mucosal Vascular Addressin Cell Adhesion Molecule 1), also known as MACAM1, is a protein that in humans is encoded by the MADCAM1 gene. By PCR-based analysis of somatic cell hybrids, this gene is mapped to chromosome 19. The protein encoded by this gene is an endothelil cell adhesion molecule that interacts preferentially with the leukocyte beta7 integrin LPAM-1 (alpha4/beta7), L-selectin, and VLA-4 (alpha4/beta1) on myeloid cells to direct leukocytes into mucosal and inflamed tissues. It is a member of the immunoglobulin superfamily and is similar to ICAM-1 and VCAM-1. |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence of human MAdCAM1 (QELEGAQALGPEVQEEEEEPQGDEDVLFRVTERWRL). |
| Other Names | [Mucosal addressin cell adhesion molecule 1; MAdCAM-1; hMAdCAM-1; MADCAM1; Mucosal vascular addressin cell adhesion molecule 1] |
| Gene, Accession # | [MAdCAM1], Gene ID: 8174, NCBI: NP_570116.2, UniProt: Q13477 |
| Catalog # | MBS1751471 |
| Price | $280 |
| Order / More Info | MAdCAM1 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Briskin, M. J., McEvoy, L. M., Butcher, E. C. MAdCAM-1 has homology to immunoglobulin and mucin-like adhesion receptors and to IgA1. Nature 363: 461-464, 1993. 2. Entrez Gene: mucosal vascular addressin cell adhesion molecule 1. 3. Leung, E., Berg, R. W., Langley, R., Greene, J., Raymond, L. A., Augustus, M., Ni, J., Carter, K. C., Spurr, N., Choo, K. H. A., Krissansen, G. W. Genomic organization, chromosomal mapping, and analysis of the 5-prime promoter region of the human MAdCAM-1 gene. Immunogenetics 46: 111-119, 1997. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies