RAB13 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-RAB13 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | RAB13 |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Ras-related protein Rab-13(RAB13) detection. Tested with WB, IHC-P in Human;Mouse;Rat. Background: Ras-related protein Rab-13 is a protein that in humans is encoded by the RAB13 gene. This gene is a member of the Rab family of small G proteins and plays a role in regulating membrane trafficking between trans-Golgi network (TGN) and recycling endosomes (RE). The encoded protein is involved in the assembly of tight junctions, which are components of the apical junctional complex (AJC) of epithelial cells. The AJC plays a role in forming a barrier between luminal contents and the underlying tissue. Additional functions associated with the protein include endocytic recycling of occludin, regulatio |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human RAB13 (121-150aa NKCDMEAKRKVQKEQADKLAREHGIRFFET), different from the related mouse and rat sequences by four amino acids. Ig Type: Rabbit IgG |
| Other Names | [Ras-related protein Rab-13; Cell growth-inhibiting gene 4 protein; GIG4; Growth inhibiting gene 4 protein; RAB13; RAB13 member RAS oncogene family; RAB13_HUMAN; RAS associated protein RAB13; Ras related protein Rab13; Ras-related protein Rab-13; RAB13, member RAS oncogene family], [RAB13; RAB13; GIG4] |
| Gene, Accession # | [RAB13], Gene ID: 5872, NCBI: NP_001258967.1, UniProt: P51153 |
| Catalog # | MBS178316 |
| Price | $315 |
| Order / More Info | RAB13 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Entrez Gene: RAB13 RAB13, member RAS oncogene family. 2. Zahraoui A, Joberty G, Arpin M, Fontaine JJ, Hellio R, Tavitian A, Louvard D (Feb 1994). A small rab GTPase is distributed in cytoplasmic vesicles in non polarized cells but colocalizes with the tight junction marker ZO-1 in polarized epithelial cells. J Cell Biol 124 (1-2): 101-15. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies