KRIT1 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-KRIT1 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | KRIT1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal antibody for Krev interaction trapped protein 1(KRIT1) detection. Background: Krev interaction trapped protein 1(KRIT1) is a protein that in humans is encoded by the CCM1 gene. This gene encodes a protein containing four ankyrin repeats, a band 4.1/ezrin/radixin/moesin (FERM) domain, and multiple NPXY sequences. The encoded protein is localized in the nucleus and cytoplasm. It binds to integrin cytoplasmic domain-associated protein-1 alpha (ICAP1alpha), and plays a critical role in beta1-integrin-mediated cell proliferation. It associates with junction proteins and RAS-related protein 1A (Rap1A), which requires the encoded protein for maintaining the integrity of endothelial junctions. It is also a microtubule-associat |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human KRIT1 (703-736aa ENKMSFIVHTKQAGLVVKLLMKLNGQLMPTERNS), different from the related mouse sequence by one amino acid. |
| Other Names | [CAM; CCM 1; CCM1; KRIT 1; KRIT1; O00522; Krev interaction trapped protein 1; KRIT1, ankyrin repeat containing], [KRIT1; KRIT1; CAM; CCM1; CCM1; Krev interaction trapped 1] |
| Gene, Accession # | [KRIT1], Gene ID: 889, NCBI: NP_001013424.1, UniProt: O00522 |
| Catalog # | MBS178830 |
| Price | $280 |
| Order / More Info | KRIT1 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Eerola I, McIntyre B, Vikkula M (Feb 2001). Identification of eight novel 5'-exons in cerebral capillary malformation gene-1 (CCM1) encoding KRIT1.Biochimica et Biophysica Acta 1517 (3): 464-7.2. Pagenstecher A, Stahl S, Sure U, Felbor U (Mar 2009).A two-hit mechanism causes cerebral cavernous malformations: complete inactivation of CCM1, CCM2 or CCM3 in affected endothelial cells. Human Molecular Genetics 18 (5): 911-8. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies