UBE1C Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-UBE1C antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | UBE1C |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for NEDD8-activating enzyme E1 catalytic subunit(UBA3) detection. Tested with WB, IHC-P in Human;Mouse;Rat. Background: NEDD8-activating enzyme E1 catalytic subunit is a protein that in humans is encoded by the UBA3 gene. The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E1 ubiquitin-activating enzyme family. The encoded enzyme associates with AppBp1, an amyloid beta precursor protein binding protein, |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human UBE1C (409-448aa KNRTLYLQSVTSIEERTRPNLSKTLKELGLVDGQELAVAD), identical to the related mouse and rat sequences. Ig Type: Rabbit IgG |
| Other Names | [NEDD8-activating enzyme E1 catalytic subunit; DKFZp566J164; EC 6.3.2.; hUba3; MGC22384; NEDD8 activating enzyme E1 catalytic subunit; NEDD8 activating enzyme E1C; Nedd8 activating enzyme hUba3; NEDD8-activating enzyme E1 catalytic subunit; NEDD8-activating enzyme E1C; uba3; UBA3 ubiquitin activating enzyme E1 homolog; UBA3_HUMAN; UBE1C; Ubiquitin activating enzyme 3; Ubiquitin activating enzyme E1C; Ubiquitin-activating enzyme 3; Ubiquitin-activating enzyme E1C; Ubiquitin-like modifier-activating enzyme 3; ubiquitin-like modifier activating enzyme 3], [UBA3; UBA3; NAE2; UBE1C; hUBA3; UBE1C; Ubiquitin-activating enzyme 3] |
| Gene, Accession # | [UBE1C], Gene ID: 9039, NCBI: NP_003959.3, UniProt: Q8TBC4 |
| Catalog # | MBS177727 |
| Price | $315 |
| Order / More Info | UBE1C Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Entrez Gene: UBE1C ubiquitin-activating enzyme E1C (UBA3 homolog, yeast). 2. Bohnsack, R. N., Haas, A. L. Conservation in the mechanism of Nedd8 activation by the human AppBp1-Uba3 heterodimer. J. Biol. Chem. 278: 26823-26830, 2003. 3. Osaka F, Kawasaki H, Aida N, Saeki M, Chiba T, Kawashima S, Tanaka K, Kato S (August 1998). A new NEDD8-ligating system for cullin-4A. Genes Dev 12 (15): 2263-8. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies