GPR2/CCR10 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-GPR2/CCR10 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | GPR2/CCR10 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Specificity: No cross reactivity with other proteins. Description: Rabbit IgG polyclonal antibody for GPR2/CCR10 detection. Tested with WB, IHC-P in Human; Mouse; Rat.Background: C-C chemokine receptor type 10 is a protein that in humans is encoded by the CCR10 gene. It is mapped to 17q21.2. Chemokines are a group of small (approximately 8 to 14 kD), mostly basic, structurally related molecules that regulate cell trafficking of various types of leukocytes through interactions with a subset of 7-transmembrane, G protein-coupled receptors. Chemokines also play fundamental roles in the development, homeostasis, and function of the immune system, and they have effects on cells of the central nervous system as well as on endothelial cells in |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence of human GPR2/CCR10 (TEATEQVSWGHYSGDEEDAYSAEPLPELCYKADVQAFSRAFQ). |
| Other Names | [C-C chemokine receptor type 10; C-C CKR-10; CC-CKR-10; CCR-10; G-protein coupled receptor 2; CCR10; GPR2; C-C motif chemokine receptor 10] |
| Gene, Accession # | [GPR2], Gene ID: 2826, NCBI: NP_057686.2, UniProt: P46092 |
| Catalog # | MBS1751476 |
| Price | $315 |
| Order / More Info | GPR2/CCR10 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Homey, B., Alenius, H., Muller, A., Soto, H., Bowman, E. P., Yuan, W., McEvoy, L., Lauerma, A. I., Assmann, T., Bunemann, E., Lehto, M., Wolff, H., 1. Homey, B., Alenius, H., Muller, A., Soto, H., Bowman, E. P., Yuan, W., McEvoy, L., Lauerma, A. I., Assmann, T., Bunemann, E., Lehto, M., Wolff, H., Yen, D., Marxhausen, H., To, W., Sedgwick, J., Ruzicka, T., Lehmann, P., Zlotnik, A.CCL27-CCR10 interactions regulate T cell-mediated skin inflammation.Nature Med. 8: 157-165, 2002. 2. Jarmin, D. I., Rits, M., Bota, D., Gerard, N. P., Graham, G. J., Clark-Lewis, I., Gerard, C.Cutting edge: identification of the orphan receptor G-protein-coupled receptor 2 as CCR10, a specific receptor for the chemokine ESkine.J. Immun. 164: 3460-3464, 2000. 3. Marchese, A., Docherty, J. M., Nguyen, T., Heiber, M., Cheng, R., Heng, H. H. Q., Tsui, L.-C., Shi, X., George, S. R., O'Dowd, B. F.Cloning of human genes encoding novel G protein-coupled receptors.Genomics 23: 609-618, 1994. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies