ANGPTL4 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-ANGPTL4 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | ANGPTL4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), ELISA (EIA) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal antibody for Angiopoietin-related protein 4(ANGPTL4) detection. Background: Angiopoietin-related protein 4 (Angptl4) is a protein that in humans is encoded by the ANGPTL4 gene. This gene is a member of the angiopoietin/angiopoietin-like gene family and encodes a glycosylated, secreted protein with a fibrinogen C-terminal domain. And this gene is induced under hypoxic conditions in endothelial cells and is the target of peroxisome proliferation activators. By radiation hybrid analysis, Angptl4 gene is mapped to 19p13.3. ANGPTL4 contributed to tumor growth and protected cells from anoikis, a form of programmed cell death induced when contact-dependent cells detach from the surrounding tissue matrix. |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ANGPTL4 (369-406aa QQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS), different from the related mouse and rat sequences by seven amino acids. |
| Other Names | [Angiopoietin like 4; Angiopoietin related protein 4; Angiopoietinlike 4; angiopoietin-like 4; Angiopoietin-like 4; Angiopoietin-like protein 4; Angiopoietinrelated protein 4; ANGL4; angptl 4; ANGPTL2; ANGPTL4; ARP4; PGAR; HFARP; pp1158; PSEC0166; TGQTL; Q9BY76], [ANGPTL4; ANGPTL4; NL2; ARP4; FIAF; HARP; PGAR; HFARP; TGQTL; UNQ171; pp1158; ARP4; HFARP; PGAR; HFARP] |
| Gene, Accession # | [ANGPTL4], Gene ID: 51129, NCBI: NP_001034756.1, UniProt: Q9BY76 |
| Catalog # | MBS178637 |
| Price | $280 |
| Order / More Info | ANGPTL4 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Romeo, S., Pennacchio, L. A., Fu, Y., Boerwinkle, E., Tybjaerg-Hansen, A., Hobbs, H. H., Cohen, J. C.Population-based resequencing of ANGPTL4 uncovers variations that reduce triglycerides and increase HDL. Nature Genet. 39: 513-516, 2007.2. Yoon, J. C., Chickering, T. W., Rosen, E. D., Dussault, B., Qin, Y., Soukas, A., Friedman, J. M., Holmes, W. E., Spiegelman, B. M.Peroxisome proliferator-activated receptor gamma target gene encoding a novel angiopoietin-related protein associated with adipose differentiation. Molec. Cell. Biol. 20: 5343-5349, 2000. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies