KPNA2/Ipoa1 Picoband Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-KPNA2/Ipoa1 Picoband antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | KPNA2/Ipoa1 Picoband |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Importin subunit alpha-2 is a protein that in humans is encoded by the KPNA2 gene. The import of proteins into the nucleus is a process that involves at least 2 steps. The first is an energy-independent docking of the protein to the nuclear envelope and the second is an energy-dependent translocation through the nuclear pore complex. Imported proteins require a nuclear localization sequence (NLS) which generally consists of a short region of basic amino acids or 2 such regions spaced about 10 amino acids apart. Proteins involved in the first step of nuclear import have been identified in different systems. These include the Xenopus protein importin and its yeast homolog, SRP1 (a suppressor of certain temperature-sensitive mutat |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human KPNA2 (2-46aa STNENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQ), different from the related mouse sequence by three amino acids. Subcellular Localization: Cytoplasm. Nucleus. Tissue Specificity: Expressed ubiquitously. |
| Other Names | [Importin subunit alpha-1; Karyopherin subunit alpha-2; RAG cohort protein 1; SRP1-alpha; KPNA2; RCH1; SRP1] |
| Gene, Accession # | [KPNA2], Gene ID: 3838, NCBI: NP_001307540.1, UniProt: P52292 |
| Catalog # | MBS1750714 |
| Price | $280 |
| Order / More Info | KPNA2/Ipoa1 Picoband Antibody from MYBIOSOURCE INC. |
| Product Specific References | n/a |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies