ITGA2B Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-ITGA2B antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | ITGA2B |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | n/a |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Specificity: No cross reactivity with other proteins. Description: Rabbit IgG polyclonal antibody for Integrin alpha-Iib(ITGA2B) detection. Tested with WB, IHC-P in Human;Mouse;Rat. Background: Integrin alpha-IIb is a protein that in humans is encoded by the ITGA2B gene. It is mapped to 17q21.32. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. Alpha chain 2b undergoes post-translational cleavage to yield disulfide-linked light and heavy chains that join with beta 3 to form a fibrinogen receptor expressed in platelets that plays a crucial role in coagulation. Mutations that interfere with this role result in thrombasthenia. In addition to adhesion, integrins are known to participate in cell |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ITGA2B (677-711aa EAELAVHLPQGAHYMRALSNVEGFERLICNQKKEN), different from the related mouse sequence by four amino acids. Ig Type: Rabbit IgG |
| Other Names | [Integrin alpha-Iib; antigen CD41; BDPLT16; BDPLT2; CD41; CD41B; form 2; GP2B; GPalpha IIb; GPIIb; GT; GTA; HPA3; Integrin alpha 2b; Integrin alpha IIb; Integrin alpha-IIb light chain; Integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41); ITA2B_HUMAN; ITGA2B; ITGAB; platelet fibrinogen receptor, alpha subunit; platelet glycoprotein IIb of IIb/IIIa complex; Platelet membrane glycoprotein IIb; platelet specific antigen BAK; integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41)], [ITGA2B; ITGA2B; GT; GTA; CD41; GP2B; HPA3; CD41B; GPIIb; BDPLT2; BDPLT16; PPP1R93; GP2B; ITGAB; GPIIb] |
| Gene, Accession # | [ITGA2B], Gene ID: 3674, NCBI: NP_000410.2, UniProt: P08514 |
| Catalog # | MBS178307 |
| Price | $315 |
| Order / More Info | ITGA2B Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Entrez Gene: ITGA2B integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41). 2. Naik UP, Parise LV (1997). Structure and function of platelet alpha IIb beta 3.. Curr. Opin. Hematol. 4(5): 317-22. 3. Quinn MJ, Byzova TV, Qin J et al. (2004). Integrin alphaIIbbeta3 and its antagonism.. Arterioscler. Thromb. Vasc. Biol. 23 (6): 945-52. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies