AHR Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-AHR antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | AHR |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Frozen/Paraffin, Immunocytochemistry (ICC), Flow Cytometry (FC/FACS) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Specificity: No cross reactivity with other proteins. Description: Rabbit IgG polyclonal antibody for AHR detection. Tested with WB, IHC-P, IHC-F, ICC, FCM in Human; Mouse; Rat.Background: AHR (aryl hydrocarbon receptor), also called bHLHe76, is a member of the family of basic helix-loop-helix transcription factors. AhR is a cytosolic transcription factor that is normally inactive, bound to several co-chaperones. The AHR gene is mapped on 7p21.1. Estrogenic actions of AHR agonists were detected in wildtype ovariectomized mouse uteri, but were absent in Ahr -/- or Er-alpha -/- ovariectomized mice. Complex assembly and ubiquitin ligase activity of CUL4B (AHR) in vitro and in vivo are dependent on the AHR ligand. In the CUL4B (AHR) complex |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence of human AHR (AFLNKFQNGVLNETYPAELNNINNTQTTTHLQPLHH). |
| Other Names | [Aryl hydrocarbon receptor; Ah receptor; AhR; Class E basic helix-loop-helix protein 76; bHLHe76; AHR; BHLHE76] |
| Gene, Accession # | [AHR], Gene ID: 196, NCBI: NP_001612.1, UniProt: P35869 |
| Catalog # | MBS1751223 |
| Price | $315 |
| Order / More Info | AHR Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Andersson, P., McGuire, J., Rubio, C., Gradin, K., Whitelaw, M. L., Pettersson, S., Hanberg, A., Poellinger, L. A constitutively active dioxin/aryl hydrocarbon receptor induces stomach tumors. Proc. Nat. Acad. Sci. 99: 9990-9995, 2002. 2. Ema, M., Matsushita, N., Sogawa, K., Ariyama, T., Inazawa, J., Nemoto, T., Ota, M., Oshimura, M., Fujii-Kuriyama, Y. Human arylhydrocarbon receptor: functional expression and chromosomal assignment to 7p21. J. Biochem. 116: 845-851, 1994. 3. Le Beau, M. M., Carver, L. A., Espinosa, R., III, Schmidt, J. V., Bradfield, C. A. Chromosomal localization of the human AHR locus encoding the structural gene for the Ah receptor to 7p21-p15. Cytogenet. Cell Genet. 66: 172-176, 1994. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies