Carboxypeptidase A Picoband Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-Carboxypeptidase A Picoband antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Carboxypeptidase A Picoband |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | unconjugated |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Carboxypeptidase A1 is an enzyme that in humans is encoded by the CPA1 gene. This gene encodes a member of the carboxypeptidase A family of zinc metalloproteases. This enzyme is produced in the pancreas and preferentially cleaves C-terminal branched-chain and aromatic amino acids from dietary proteins. This gene and several family members are present in a gene cluster on chromosome 7. Mutations in this gene may be linked to chronic pancreatitis, while elevated protein levels may be associated with pancreatic cancer. Protein Function: Carboxypeptidase that catalyzes the release of a C- terminal amino acid, but has little or no action with -Asp, -Glu, -Arg, -Lys or -Pro. |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence of human Carboxypeptidase A (KRPAIWIDTGIHSREWVTQASGVWFAKKITQDYGQDAAFTAILDTLD). Subcellular Localization: Secreted. |
| Other Names | [Carboxypeptidase A1; CPA1; CPA] |
| Gene, Accession # | [CPA1], Gene ID: 1357, NCBI: NP_001859.1, UniProt: P15085 |
| Catalog # | MBS1750906 |
| Price | $280 |
| Order / More Info | Carboxypeptidase A Picoband Antibody from MYBIOSOURCE INC. |
| Product Specific References | n/a |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies