GSTA1/A2/A3/A4/A5 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-GSTA1/A2/A3/A4/A5 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | GSTA1/A2/A3/A4/A5 |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | mouse, rat. predicted to work with: human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Glutathione S-transferase A1/A2/A3/A4/A5(GSTA1/A2/A3/A4/A5) detection. Tested with WB in Human; Mouse;Rat. Background: Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes function in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding these enzymes are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of some drugs. At present, eight distinct classes of the solub |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human GSTA1/A2/A3/A4/A5 (63-97aa MKLVQTRAILNYIASKYNLYGKDIKERALIDM YIE), different from the related mouse and rat sequences by five amino acids. Ig Type: Rabbit IgG |
| Other Names | [Glutathione S-transferase A1/A2/A3/A4/A5; GST 2; GST class alpha; GST class alpha 1; GST class alpha member 1; GST epsilon; GST HA subunit 1; GST, class alpha, 1; GST-epsilon; GST2; GSTA 1; GSTA1 1; GSTA1; GSTA1 protein; GSTA1-1; GSTA1_HUMAN; GTH 1; GTH1; HA subunit 1; MGC131939; EC 2.5.1.18; GST 1b-1b; GST A2-2; GST class alpha member 2; GST gamma; GST HA subunit 2; GST Ya2; GST, class alpha, 2; GST2; Gst2-2; GSTA2 2; GSTA2-2; Gstc-2; Gstc2; GTA2; GTH2; HA subunit 2; Liver GST2; MGC10525; GST 2 2; GST AA; GST class alpha; GST class alpha member 3; GST Yc1; GSTA 3; GSTA3 3; Gsta3; GSTA3-3; GSTA3_HUMAN; Gstyc; GTA 3; GTA3; Yc1; GSTA4 4; GSTA4; GSTA4_HUMAN; GTA4; GST A5 5; GST class-alpha member 5; GST Yc2; GSTA5; GSTA5_HUMAN; glutathione S-transferase alpha 1/2/3/4/5], [GSTA1; GSTA1; GST2; GTH1; GSTA1-1; GST-epsilon] |
| Gene, Accession # | [GSTA1/A2/A3/A4/A5], Gene ID: 2938, NCBI: NP_665683.1, UniProt: P08263 |
| Catalog # | MBS178171 |
| Price | $280 |
| Order / More Info | GSTA1/A2/A3/A4/A5 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Atkinson, HJ; Babbitt, PC (Nov 24, 2009). Glutathione transferases are structural and functional outliers in the thioredoxin fold.. Biochemistry 48 (46): 11108-16. 2. Boyer TD (March 1989). The glutathione S-transferases: an update. Hepatology 9(3): 486-96. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies