Edit |   |
---|---|
Antigenic Specificity | ATP1A3 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | mouse, rat |
Isotype | n/a |
Format | affinity purified |
Size | 0.1 mL |
Concentration | 0.82 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The catalytic subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes an alpha 3 subunit. Alternatively spliced transcript variants en |
Immunogen | Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human ATP1A3 (NP 689509.1). Immunogen Sequence: MGDKKDDKDSPKKNKGKERRDLDDLKKEVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQE |
Other Names | [ATP1A3; AHC2; ATP1A1; CAPOS; DYT12; RDP; ATPase Na+/K+ transporting subunit alpha 3] |
Gene, Accession # | [ATP1A3], Gene ID: 478, NCBI: NP_001243142.1, UniProt: P13637 |
Catalog # | MBS9140680 |
Price | $260 |
Order / More Info | ATP1A3 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |